| 產(chǎn)品詳情 |
| Edit |   |
| Antigenic Specificity | ABCA7 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. For ICC/IF, Fixation/Permeabilization: PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The ABCA7 Antibody from Novus Biologicals is a rabbit polyclonal antibody to ABCA7. This antibody reacts with human. The ABCA7 Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human ABCA7 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: VNRTFEELTLLRDVREVWEMLGPRIFTFMNDSSNVAMLQRLLQMQDEGRR QPRPGGRDHMEALRSFLDPGSGGYSWQDAHADVGHL |
| Other Names | ABCA-SSN, ABCXATP-binding cassette sub-family A member 7, ATP-binding cassette, sub-family A (ABC1), member 7, Autoantigen SS-N, EC 2.2.1.1, EC 3.6.3, EC 3.6.3.41, FLJ40025, Macrophage ABC transporter |
| Gene, Accession # | ABCA7, Gene ID: 10347, Accession: Q8IZY2, SwissProt: Q8IZY2 |
| Catalog # | NBP2-14250 |
| Price | |
| Order / More Info | ABCA7 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 產(chǎn)品資料 |
|
|