If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY.
Description
The ABCB10 Antibody from Novus Biologicals is a rabbit polyclonal antibody to ABCB10. This antibody reacts with mouse. The ABCB10 Antibody has been validated for the following applications: Western Blot.
Immunogen
Synthetic peptides corresponding to Abcb10 (ATP-binding cassette, sub-family B (MDR/TAP), member 10) The peptide sequence was selected from the N terminal of Abcb10. Peptide sequence NGIRVYLMQSSGQSIVNRLRTSLFSSILRQEVAFFDKTRTGELINRLSSD.
Other Names
ABC transporter 10 protein, ATP-binding cassette, sub-family B (MDR/TAP), member 10, EC 3.6.3, EC 3.6.3.44, EST20237, M-ABC2ATP-binding cassette transporter 10, Mitochondrial ATP-binding cassette 2, MTABC2ATP-binding cassette sub-family B member 10, mitochondrial