| 產(chǎn)品詳情 |
| Edit |   |
| Antigenic Specificity | ST3GAL4 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The ST3GAL4 Antibody from Novus Biologicals is a rabbit polyclonal antibody to ST3GAL4. This antibody reacts with human. The ST3GAL4 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human ST3GAL4 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: SREDRYIELFYFPIPEKKEPCLQGEAESKASKLFGNYSRDQPIFLRLEDY FWVKTPSAYE |
| Other Names | Alpha 2,3-sialyltransferase IV, Alpha 2,3-ST 4, Beta-galactoside alpha-2,3-sialyltransferase 4, CGS23FLJ46764, EC 2.4.99, EC 2.4.99.-, EC 2.4.99.9, FLJ11867, gal-beta-1,4-GalNAc-alpha-2,3-sialyltransferase, Gal-NAc6S, NANTA3alpha-3-N-acetylneuraminyltransferase, SAT3, SAT-3, Sialyltransferase 4C, sialyltransferase 4C (beta-galactosidase alpha-2,3-sialytransferase), sialyltransferase 4C (beta-galactoside alpha-2,3-sialytransferase), SIAT4-C, SIAT4CCMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 4, ST3 beta-galactoside alpha-2,3-sialyltransferase 4, ST3Gal IV, ST3GalA.2, ST3GalIV, ST-4, STZSIAT4 |
| Gene, Accession # | ST3GAL4, Gene ID: 6484 |
| Catalog # | NBP2-13390 |
| Price | |
| Order / More Info | ST3GAL4 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 產(chǎn)品資料 |
|
|