| 產(chǎn)品詳情 |
| Edit |   |
| Antigenic Specificity | ST3GAL5 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The ST3GAL5 Antibody from Novus Biologicals is a rabbit polyclonal antibody to ST3GAL5. This antibody reacts with human. The ST3GAL5 Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human ST3GAL5 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: NKTTIRMTYPEGAPLSDLEYYSNDLFVAVLFKSVDFNWLQAMVKKETLPFWVRLFFWKQVAEKIPLQPKHFRILNPVIIKETAFDILQYSEPQSRFWG |
| Other Names | alpha 2,3-sialyltransferase V, CMP-NeuAc:lactosylceramide alpha-2,3-sialyltransferase, EC 2.4.99.9, Ganglioside GM3 synthase, GM3 synthase, lactosylceramide alpha-2,3-sialyltransferase, Sialyltransferase 9, sialyltransferase 9 (CMP-NeuAc:lactosylceramide alpha-2,3-sialyltransferase;GM3 synthase), SIATGM3S, ST3 beta-galactoside alpha-2,3-sialyltransferase 5, ST3Gal V, ST3GALV, ST3GalVSIAT9SATI |
| Gene, Accession # | ST3GAL5, Gene ID: 8869 |
| Catalog # | NBP2-56522 |
| Price | |
| Order / More Info | ST3GAL5 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 產(chǎn)品資料 |
|
|