If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY.
Description
The ST6GALNAC1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to ST6GALNAC1. This antibody reacts with mouse. The ST6GALNAC1 Antibody has been validated for the following applications: Western Blot.
Immunogen
The immunogen for this antibody is St6galnac1. Peptide sequence GALLLLTALHLCDKVSAYGFITEGHQRFSDHYYDTSWKRLIFYINHDFRL.
Other Names
alpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase 1, EC 2.4.99.3, GalNAc alpha-2, 6-sialyltransferase I, long form, GalNAc alpha-2,6-sialyltransferase I, sialyltransferase 7((alpha-N-acetylneuraminyl-2,3-beta-galactosyl-1,3)-N-acetyl galactosaminidealpha-2,6-sialyltransferase) A, Sialyltransferase 7A, SIAT7A, SIAT7-A, ST6 (alpha-N-acetyl-neuraminyl-2,3-beta-galactosyl-1,3)-N-acetylgalactosaminidealpha-2,6-sialyltransferase 1, ST6GalNAc I, ST6GalNAcIHSY11339, STYI