| 產(chǎn)品詳情 |
| Edit |   |
| Antigenic Specificity | ST6GALNAC3 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The ST6GALNAC3 Antibody from Novus Biologicals is a rabbit polyclonal antibody to ST6GALNAC3. This antibody reacts with human. The ST6GALNAC3 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptides corresponding to ST6GALNAC3(ST6-N-acetylgalactosaminide alpha-2,6-sialyltransferase 3) The peptide sequence was selected from the C terminal of ST6GALNAC3. Peptide sequence HYYEQGRDECDEYFLHEHAPYGGHRFITEKKVFAKWAKKHRIIFTHP |
| Other Names | alpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase 3, alpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase III, EC 2.4.99.-, EC 2.4.99.7, FLJ13669, FLJ27239, GalNAc alpha-2,6-sialyltransferase III, PRO7177, sialyltransferase 7((alpha-N-acetylneuraminyl-2,3-beta-galactosyl-1,3)-N-acetyl galactosaminidealpha-2,6-sialyltransferase) C, Sialyltransferase 7C, SIAT7C, SIAT7-C, ST6 (alpha-N-acetyl-neuraminyl-2,3-beta-galactosyl-1,3)-N-acetylgalactosaminidealpha-2,6-sialyltran, ST6 (alpha-N-acetyl-neuraminyl-2,3-beta-galactosyl-1,3)-N-acetylgalactosaminidealpha-2,6-sialyltransferase 3, ST6GalNAc III, ST6GALNACIII, STY |
| Gene, Accession # | ST6GALNAC3, Gene ID: 256435, Accession: Q8NDV1, SwissProt: Q8NDV1 |
| Catalog # | NBP1-69326 |
| Price | |
| Order / More Info | ST6GALNAC3 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 產(chǎn)品資料 |
|
|