| 產(chǎn)品詳情 |
| Edit |   |
| Antigenic Specificity | Lactate Dehydrogenase B |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The Lactate Dehydrogenase B Antibody from Novus Biologicals is a rabbit polyclonal antibody to Lactate Dehydrogenase B. This antibody reacts with human. The Lactate Dehydrogenase B Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human Lactate Dehydrogenase B antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: HPVSTMVKGMYGIENEVFLSLPCILNARGLTSVINQKLKDDEVAQLKKSADTLWDIQKDLKDL |
| Other Names | EC 1.1.1, EC 1.1.1.27, lactate dehydrogenase B, LDH heart subunit, LDH-B, LDH-H, L-lactate dehydrogenase B chain, Renal carcinoma antigen NY-REN-46, TRG-5 |
| Gene, Accession # | LDHB, Gene ID: 3945, Accession: P07195, SwissProt: P07195 |
| Catalog # | NBP2-38131 |
| Price | |
| Order / More Info | Lactate Dehydrogenase B Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 產(chǎn)品資料 |
|
|