If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY.
Description
The CKII alpha prime polypeptide Antibody from Novus Biologicals is a rabbit polyclonal antibody to CKII alpha prime polypeptide. This antibody reacts with human. The CKII alpha prime polypeptide Antibody has been validated for the following applications: Western Blot.
Immunogen
Synthetic peptides corresponding to CSNK2A2(casein kinase 2, alpha prime polypeptide) The peptide sequence was selected from the C terminal of CSNK2A2. Peptide sequence LLDKLLRYDHQQRLTAKEAMEHPYFYPVVKEQSQPCADNAVLSSGLTAAR.
Other Names
casein kinase 2, alpha prime polypeptide, casein kinase II subunit alpha', CK II alpha', CK2A2, CSNK2A1, EC 2.7.11, EC 2.7.11.1, FLJ43934