| Edit |   |
|---|
| Antigenic Specificity | Mitochondrial-processing peptidase subunit beta |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Mitochondrial-processing peptidase subunit beta Antibody from Novus Biologicals is a rabbit polyclonal antibody to Mitochondrial-processing peptidase subunit beta. This antibody reacts with human. The Mitochondrial-processing peptidase subunit beta Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human Mitochondrial-processing peptidase subunit beta antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: SEVARARNLLKTNMLLQLDGSTPICEDIGRQMLCYNRRIPIPELEARIDAVNAETIREVCTKYIYNRSPAIAAVGPIKQLPDFKQIRSNMCWLR |
|---|
| Other Names | Beta-MPP, EC 3.4.24.64, mitochondrial processing peptidase beta subunit, mitochondrial-processing peptidase subunit beta, MPPBMPP11, MPPP52, P-52, peptidase (mitochondrial processing) beta |
|---|
| Gene, Accession # | PMPCB, Gene ID: 9512 |
|---|
| Catalog # | NBP2-56461 |
|---|
| Price | |
|---|
| Order / More Info | Mitochondrial-processing peptidase subunit beta Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|