Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Reviews / Ratings
If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY.
Description
The Cadherin-17 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Cadherin-17. This antibody reacts with human. The Cadherin-17 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human Cadherin-17 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins
Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: HPIKITQVRWNDPGAQYSLVDKEKLPRFPFSIDQEGDIYVTQPLDREEKDAYVFYAVAKDEYGKPLSYPLEIHVKVK
Other Names
cadherin, cadherin 17, LI cadherin (liver-intestine), cadherin-16, cadherin-17, CDH16, FLJ26931, HPT1, HPT-1, HPT-1 cadherin, human intestinal peptide-associated transporter HPT-1, human peptide transporter 1, Intestinal peptide-associated transporter HPT-1, LI cadherin, LI-cadherin, Liver-intestine cadherin, MGC138218, MGC142024