| 產(chǎn)品詳情 |
| Edit |   |
| Antigenic Specificity | ATPAF2 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human, rat |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The ATPAF2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to ATPAF2. This antibody reacts with human, rat. The ATPAF2 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human, mouse, rat ATPAF2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: QDTIKYYTMHLTTLCNTSLDNPTQRNKDQLIRAAVKFLDTDTICYRVEEPETLVELQRNEWDPIIEWAEKRYGVEISSSTSIMGPSIPAKT |
| Other Names | ATP synthase mitochondrial F1 complex assembly factor 2, ATP12 homolog, ATP12LP3663, Atp12p, MGC29736 |
| Gene, Accession # | ATPAF2, Gene ID: 91647 |
| Catalog # | NBP1-88885 |
| Price | |
| Order / More Info | ATPAF2 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 產(chǎn)品資料 |
|
|