If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY.
Description
The NECAB3 Antibody from Novus Biologicals is a rabbit polyclonal antibody to NECAB3. This antibody reacts with human. The NECAB3 Antibody has been validated for the following applications: Western Blot.
Immunogen
Synthetic peptides corresponding to NECAB3 (N-terminal EF-hand calcium binding protein 3) The peptide sequence was selected from the N terminal of NECAB3)(50ug). Peptide sequence MACAGLLTVCLLRPPAPQPQPQTPRHPQLAPDPGPAGHTLFQDVFRRADK.
Other Names
Amyloid beta A4 protein-binding family A member 2-binding protein, APBA2BPfamily A, member 2 binding protein, dJ63M2.4, dJ63M2.5, EFCBP3STIP3, EF-hand calcium binding protein 3, Neuronal calcium-binding protein 3, neuronal calcium-binding protein NECAB3, NIP1Nek2-interacting protein 1, N-terminal EF-hand calcium binding protein 3, N-terminal EF-hand calcium-binding protein 3, synaptotagmin interacting protein 2, synaptotagmin interacting protein STIP3, SYTIP2, XB51X11L-binding protein 51