| Edit |   |
|---|
| Antigenic Specificity | NECAP2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The NECAP2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to NECAP2. This antibody reacts with human. The NECAP2 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to NECAP2(NECAP endocytosis associated 2) The peptide sequence was selected from the N terminal of NECAP2. Peptide sequence WQLDQPSWSGRLRITAKGQMAYIKLEDRTSGELFAQAPVDQFPGTAVESV. |
|---|
| Other Names | adaptin ear-binding coat-associated protein 2, adaptin-ear-binding coat-associated protein 2, FLJ10420, NECAP endocytosis associated 2, NECAP endocytosis-associated protein 2, NECAP-2 |
|---|
| Gene, Accession # | NECAP2, Gene ID: 55707, Accession: Q9NVZ3, SwissProt: Q9NVZ3 |
|---|
| Catalog # | NBP1-57626 |
|---|
| Price | |
|---|
| Order / More Info | NECAP2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|