Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Reviews / Ratings
If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY.
Description
The STEAP3/TSAP6 Antibody from Novus Biologicals is a rabbit polyclonal antibody to STEAP3/TSAP6. This antibody reacts with human. The STEAP3/TSAP6 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human STEAP3/TSAP6 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins
Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: PKRTARLFPSAAQVTFQEEAVSSPEVIFVAVFREHYSSLCSLSDQLAGKI LVDVSNPTEQEHLQHRE
Other Names
dudlin 2, dudlin-2, dudulin 2, dudulin-2, Dudulin-2,1010001D01Rik, EC 1.16.1.-, hpHyde, hTSAP6, metalloreductase STEAP3, pHyde, six transmembrane prostate protein 3, Six-transmembrane epithelial antigen of prostate 3, STEAP family member 3, TSAP6STMP3, tumor suppressor pHyde, Tumor suppressor-activated pathway protein 6