| 產(chǎn)品詳情 |
| Edit |   |
| Antigenic Specificity | STEAP3/TSAP6 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The STEAP3/TSAP6 Antibody from Novus Biologicals is a rabbit polyclonal antibody to STEAP3/TSAP6. This antibody reacts with human. The STEAP3/TSAP6 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human STEAP3/TSAP6 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: PKRTARLFPSAAQVTFQEEAVSSPEVIFVAVFREHYSSLCSLSDQLAGKI LVDVSNPTEQEHLQHRE |
| Other Names | dudlin 2, dudlin-2, dudulin 2, dudulin-2, Dudulin-2,1010001D01Rik, EC 1.16.1.-, hpHyde, hTSAP6, metalloreductase STEAP3, pHyde, six transmembrane prostate protein 3, Six-transmembrane epithelial antigen of prostate 3, STEAP family member 3, TSAP6STMP3, tumor suppressor pHyde, Tumor suppressor-activated pathway protein 6 |
| Gene, Accession # | STEAP3, Gene ID: 55240 |
| Catalog # | NBP2-13395 |
| Price | |
| Order / More Info | STEAP3/TSAP6 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 產(chǎn)品資料 |
|
|