| 產(chǎn)品詳情 |
| Edit |   |
| Antigenic Specificity | STEP |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The STEP Antibody from Novus Biologicals is a rabbit polyclonal antibody to STEP. This antibody reacts with human. The STEP Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human, mouse STEP antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: PEDRRQSVSRQPSFTYSEWMEEKIEDDFLDLDPVPETPVFDCVMDIKPEADPTSLTVKSMGL |
| Other Names | EC 3.1.3.48, FLJ14427, Neural-specific protein-tyrosine phosphatase, protein tyrosine phosphatase, non-receptor type 5 (striatum-enriched), protein-tyrosine phosphatase striatum-enriched, STEPPTPSTEP, Striatum-enriched protein-tyrosine phosphatase, tyrosine-protein phosphatase non-receptor type 5 |
| Gene, Accession # | PTPN5, Gene ID: 84867 |
| Catalog # | NBP1-87186 |
| Price | |
| Order / More Info | STEP Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 產(chǎn)品資料 |
|
|