Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Reviews / Ratings
If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY.
Description
The p53R2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to p53R2. This antibody reacts with human. The p53R2 Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human p53R2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins
Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: MGDPERPEAAGLDQDERSSSDTNESEIKSNEEPLLRKSSRRFV
Other Names
EC 1.17.4.1, MGC102856, MGC42116, MTDPS8A, MTDPS8B, p53-inducible ribonucleotide reductase small subunit 2 homolog, p53-inducible ribonucleotide reductase small subunit 2-like protein, p53R2, P53R2DKFZp686M05248, PEOA5, ribonucleoside-diphosphate reductase subunit M2 B, ribonucleotide reductase M2 B (TP53 inducible), TP53-inducible ribonucleotide reductase M2 B