Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Reviews / Ratings
If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY.
Description
The PRAF1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to PRAF1. This antibody reacts with human. The PRAF1 Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human PRAF1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins
Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: LPPCYDDAAKPEDVYKFEDLLSPAEYEALQSPSEAFRNVTSEEILKMIEENSHCTFVIEALKSLPSDVESRDRQARCIWFLDTLIKFRAHRVVKRKSALGP
Other Names
DNA-directed RNA polymerase I subunit E, DNA-directed RNA polymerase I subunit RPA49, FLJ13390, FLJ13970, FLJ43482, PAF53RNA polymerase I-associated factor 1, polymerase (RNA) I associated factor 1, polymerase (RNA) I polypeptide E, 53kDa, PRAF1, RNA polymerase I associated factor 53, RNA polymerase I subunit A49, RNA polymerase I-associated factor 53, RP11-405L18.3