If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY.
Description
The PRAF1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to PRAF1. This antibody reacts with human, mouse. The PRAF1 Antibody has been validated for the following applications: Western Blot. This product is specific to Subunit or Isoform: RPA49
Immunogen
Synthetic peptides corresponding to POLR1E (polymerase (RNA) I polypeptide E, 53kDa) The peptide sequence was selected from the N terminal of POLR1E)(50ug). Peptide sequence SPGNMRFTLYENKDSTNPRKRNQRILAAETDRLSYVGNNFGTGALKCNTL.
Other Names
DNA-directed RNA polymerase I subunit E, DNA-directed RNA polymerase I subunit RPA49, FLJ13390, FLJ13970, FLJ43482, PAF53RNA polymerase I-associated factor 1, polymerase (RNA) I associated factor 1, polymerase (RNA) I polypeptide E, 53kDa, PRAF1, RNA polymerase I associated factor 53, RNA polymerase I subunit A49, RNA polymerase I-associated factor 53, RP11-405L18.3