| Edit |   |
|---|
| Antigenic Specificity | Discs, Large Homolog 4 (Drosophila) (DLG4) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50 μg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | This gene encodes a member of the membrane-associated guanylate kinase (MAGUK) family. It heteromultimerizes with another MAGUK protein, DLG2, and is recruited into NMDA receptor and potassium channel clusters. These two MAGUK proteins may interact at postsynaptic sites to form a multimeric scaffold for the clustering of receptors, ion channels, and associated signaling proteins. Multiple transcript variants encoding different isoforms have been found for this gene. |
|---|
| Immunogen | DLG4 antibody was raised using a synthetic peptide corresponding to a region with amino acids AAHLHPIAIFIRPRSLENVLEINKRITEEQARKAFDRATKLEQEFTECFS |
|---|
| Other Names | 11|CG1725|CG1730|CPD|DLG|DLG-A|Discs-large|Dlg|Dlg-A|Dlg1|DlgA|Dmel\\CG1725|Drodlg|PSD95|SAP97|anon-EST:Posey93|anon-WO03040301.258|anon-WO03040301.260|anon-WO03040301.268|d. lg.-1|dlg|dlg-1|dlg-A|dlgA|dlgS97|l(1)10Bf|l(1)G0276|l(1)G0342|l(1)G0456|l(1)G19|l(1)L11|l(1)bwn|l(1)d.lg-1|l(1)d.lg.-1|l(1)discs large|l(1)dlg|l(1)dlg-1|l(1)dlg1|l(1)l.pr.-2|l(1)lpr-2|misb|dlgh4|psd95|sap90|sap-90|LLGL1|Dlgh4|PSD-95|SAP90|SAP90A|Sap90|SAP-90|DLG4 |
|---|
| Gene, Accession # | Gene ID: 1742 |
|---|
| Catalog # | ABIN632653 |
|---|
| Price | |
|---|
| Order / More Info | Discs, Large Homolog 4 (Drosophila) (DLG4) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|