| Edit |   |
| Antigenic Specificity | BTLA |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human (antigen sequence identity: mouse 57%, rat 58%) |
| Isotype | n/a |
| Format | antigen affinity purified |
| Size | 100 μl |
| Concentration | n/a |
| Applications | IHC. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Rabbit anti-human BTLA polyclonal antibody. |
| Immunogen | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: ETGIYDNDPDLCFRMQEGSEVYSNPCLEENKPGIVYASLNHSVIGLNSRLARNVKEAPTE |
| Other Names | B and T lymphocyte associated, BTLA1, CD272 |
| Gene, Accession # | Gene ID: 151888, UniProt: Q7Z6A9, ENSG00000186265 |
| Catalog # | HPA062029 |
| Price | |
| Order / More Info | BTLA Antibody from ATLAS ANTIBODIES AB |
| Product Specific References | n/a |