| Edit |   |
| Antigenic Specificity | Adenosine Deaminase, RNA-Specific, B1 (ADARB1) |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | affinity purified |
| Size | 50 μg |
| Concentration | n/a |
| Applications | Western Blotting (WB) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | ADARB1 is an enzyme responsible for pre-mRNA editing of the glutamate receptor subunit B by site-specific deamination of adenosines. Studies in rat found that this enzyme acted on its own pre-mRNA molecules to convert an AA dinucleotide to an AI dinucleotide which resulted in a new splice site. |
| Immunogen | ADARB1 antibody was raised using a synthetic peptide corresponding to a region with amino acids NMSSSSTDVKENRNLDNVSPKDGSTPGPGEGSQLSNGGGGGPGRKRPLEE |
| Other Names | ADARB1|RED1|ADAR2|DRABA2|DRADA2|1700057H01Rik|AW124433|AW558573|Adar2|BB220382|D10Bwg0447e|Red1|adar2|adarb1|red1 |
| Gene, Accession # | Gene ID: 104 |
| Catalog # | ABIN633372 |
| Price | |
| Order / More Info | Adenosine Deaminase, RNA-Specific, B1 (ADARB1) Antibody from ANTIBODIES-ONLINE GmbH |
| Product Specific References | n/a |