| Edit |   |
| Antigenic Specificity | Adenosine Deaminase, RNA-Specific, B2 (ADARB2) |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | affinity purified |
| Size | 50 μg |
| Concentration | n/a |
| Applications | Western Blotting (WB) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | ADARB2 is a member of the double-stranded RNA adenosine deaminase family of RNA-editing enzymes and may play a regulatory role in RNA editing. |
| Immunogen | ADARB2 antibody was raised using a synthetic peptide corresponding to a region with amino acids SYRHNRPLLSGVSDAEARQPGKSPPFSMNWVVGSADLEIINATTGRRSCG |
| Other Names | Adar3|RED2|Red2|ADAR3|si:dkey-255g15.1 |
| Gene, Accession # | Gene ID: 105 |
| Catalog # | ABIN633530 |
| Price | |
| Order / More Info | Adenosine Deaminase, RNA-Specific, B2 (ADARB2) Antibody from ANTIBODIES-ONLINE GmbH |
| Product Specific References | n/a |