| Edit |   |
|---|
| Antigenic Specificity | ZPBP |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The ZPBP Antibody from Novus Biologicals is a rabbit polyclonal antibody to ZPBP. This antibody reacts with human. The ZPBP Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human ZPBP antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: LSCEISLLKSECHRVKMQRAGLQNELFFAFSVSSLDTEKGPKRCTDHNCEPYKRLFKAKNLIERFFNQQVEILG |
|---|
| Other Names | KIAA0395TIX1, triple homeobox 1, Triple homeobox protein 1, Zinc finger and homeodomain protein 3, zinc fingers and homeoboxes 3, zinc fingers and homeoboxes protein 3 |
|---|
| Gene, Accession # | ZPBP, Gene ID: 11055, Accession: Q9BS86, SwissProt: Q9BS86 |
|---|
| Catalog # | NBP2-31726 |
|---|
| Price | |
|---|
| Order / More Info | ZPBP Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 24309898 |
|---|