| Edit |   |
|---|
| Antigenic Specificity | ZPLD1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 20 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The ZPLD1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to ZPLD1. This antibody reacts with human. The ZPLD1 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to ZPLD1(zona pellucida-like domain containing 1) The peptide sequence was selected form the C terminal of ZPLD1. Peptide sequence DAGRRTTWSPQSSSGSAVLSAGPIITRSDETPTNNSQLGSPSMPPFQLNA. |
|---|
| Other Names | zinc finger and homeodomain protein 1, zinc fingers and homeobox 1, zinc fingers and homeoboxes 1, zinc fingers and homeoboxes protein 1, zinc-fingers and homeoboxes 1 |
|---|
| Gene, Accession # | ZPLD1, Gene ID: 131368, Accession: Q8TCW7, SwissProt: Q8TCW7 |
|---|
| Catalog # | NBP1-62724-20ul |
|---|
| Price | |
|---|
| Order / More Info | ZPLD1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|