If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY.
Description
Vacuolar ATPase is responsible for acidifying a variety of intracellular compartments in eukaryotic cells.Multisubunit vacuolar-type proton pumps, or H(+)-ATPases, acidify various intracellular compartments, such as vacuoles, clathrin-coated and synaptic vesicles, endosomes, lysosomes, and chromaffin granules.
Immunogen
ATP6 V6 2 antibody was raised using the middle region of ATP6 6 2 corresponding to a region with amino acids TVAPLSLTTPSSGPSPTQLCLVTSSLLLAPRDPDPQGLPGSWKSSQSSQP