| Edit |   |
| Antigenic Specificity | Endoplasmic Reticulum Lectin 1 (ERLEC1) (Middle Region) |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | affinity purified |
| Size | 50 μg |
| Concentration | n/a |
| Applications | Western Blotting (WB) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | C2orf30 is a probable lectin that binds selectively to improperly folded lumenal proteins. May function in endoplasmic reticulum quality control and endoplasmic reticulum-associated degradation (ERAD) of both non-glycosylated proteins and glycoproteins. |
| Immunogen | C2 orf30 antibody was raised using the middle region of C2 rf30 corresponding to a region with amino acids GKHVHQYHEDKDSGKTSVVVGTWNQEEHIEWAKKNTARAYHLQDDGTQTV |
| Other Names | C2orf30|CIM|CL24936|CL25084|XTP3-B|XTP3TPB|4933407N01Rik |
| Gene, Accession # | Gene ID: 27248 |
| Catalog # | ABIN632582 |
| Price | |
| Order / More Info | Endoplasmic Reticulum Lectin 1 (ERLEC1) (Middle Region) Antibody from ANTIBODIES-ONLINE GmbH |
| Product Specific References | n/a |