| Edit |   |
| Antigenic Specificity | Family with Sequence Similarity 83, Member B (FAM83B) (C-Term) |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | affinity purified |
| Size | 50 μg |
| Concentration | n/a |
| Applications | Western Blotting (WB) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The function of FAM83B protein has not been widely studied, and is yet to be fully elucidated. |
| Immunogen | FAM83 B antibody was raised using the C terminal of FAM83 corresponding to a region with amino acids PRRKHSSSSNSQGSIHKSKEDVTVSPSQEINAPPDENKRTPSPGPVESKF |
| Other Names | fam83b|C6orf143|C530008M07Rik|Gm516 |
| Gene, Accession # | Gene ID: 222584 |
| Catalog # | ABIN631856 |
| Price | |
| Order / More Info | Family with Sequence Similarity 83, Member B (FAM83B) (C-Term) Antibody from ANTIBODIES-ONLINE GmbH |
| Product Specific References | n/a |