| Edit |   |
|---|
| Antigenic Specificity | S100Z |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50ug |
|---|
| Concentration | n/a |
|---|
| Applications | WB |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Rabbit Polyclonal Anti-S100Z Antibody |
|---|
| Immunogen | The immunogen for Anti-S100Z antibody is: synthetic peptide directed towards the N-terminal region of Human S100Z. Synthetic peptide located within the following region: MPTQLEMAMDTMIRIFHRYSGKERKRFKLSKGELKLLLQRELTEFLSCQK |
|---|
| Other Names | Gm625, S100zeta, S100 calcium binding protein Z |
|---|
| Gene, Accession # | S100Z, Accession: NM_130772 |
|---|
| Catalog # | TA330302 |
|---|
| Price | |
|---|
| Order / More Info | S100Z Antibody from ORIGENE TECHNOLOGIES |
|---|
| Product Specific References | n/a |
|---|