| Edit |   |
|---|
| Antigenic Specificity | Ccnb1ip1 - N-terminal region |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | mouse; human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50ug |
|---|
| Concentration | n/a |
|---|
| Applications | WB |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Rabbit Polyclonal Anti-Ccnb1ip1 Antibody - N-terminal region |
|---|
| Immunogen | The immunogen for Anti-Ccnb1ip1 antibody is synthetic peptide directed towards the N-terminal region of Mouse Ccnb1ip1. Synthetic peptide located within the following region: CEDMLLCNYRKCRIKLSGYAWVTACSHIFCDQHGSGEFSRSPAICPACNS |
|---|
| Other Names | C14orf18, HEI10, cyclin B1 interacting protein 1, E3 ubiquitin protein ligase |
|---|
| Gene, Accession # | Ccnb1ip1, Accession: NM_001111119 |
|---|
| Catalog # | TA344340 |
|---|
| Price | |
|---|
| Order / More Info | Ccnb1ip1 - N-terminal region Antibody from ORIGENE TECHNOLOGIES |
|---|
| Product Specific References | n/a |
|---|