| Edit |   |
| Antigenic Specificity | SMNDC1 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human (antigen sequence identity: mouse 100%, rat 98%) |
| Isotype | n/a |
| Format | antigen affinity purified |
| Size | 100 μl |
| Concentration | n/a |
| Applications | ICC-IF |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Rabbit anti-human SMNDC1 polyclonal antibody. |
| Immunogen | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: VEAALSGNGENEDLLKLKKDLQEVIELTKDLLSTQPSETLASSDSFASTQPTHSWKVGDKCMA |
| Other Names | survival motor neuron domain containing 1, SMNR, SPF30, TDRD16C |
| Gene, Accession # | Gene ID: 10285, UniProt: O75940, ENSG00000119953 |
| Catalog # | HPA061214 |
| Price | |
| Order / More Info | SMNDC1 Antibody from ATLAS ANTIBODIES AB |
| Product Specific References | n/a |