| Edit |   |
| Antigenic Specificity | Suppressor of Cytokine Signaling 7 (SOCS7) (N-Term) |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human, mouse, rat |
| Isotype | n/a |
| Format | affinity purified |
| Size | 50 μg |
| Concentration | n/a |
| Applications | Western Blotting (WB) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | SOCS7 regulates signaling cascades probably through protein ubiquitination and/or sequestration. SOCS7 functions in insulin signaling and glucose homeostasis through IRS1 ubiquitination and subsequent proteasomal degradation. SOCS7 inhibits also prolactin, growth hormone and leptin signaling by preventing STAT3 and STAT5 activation, sequestering them in the cytoplasm and reducing their binding to DNA. SOCS7 may be a substrate recognition component of a SCF-like E3 ubiquitin-protein ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins. |
| Immunogen | SOCS7 antibody was raised using the N terminal of SOCS7 corresponding to a region with amino acids LDPKALPPGLALERTWGPAAGLEAQLAALGLGQPAGPGVKTVGGGCCPCP |
| Other Names | GB13951|zgc:175115|SOCS4|SOCS7|socs7|3110032M18Rik|A730004F22Rik|AI427843|AU015727|AU015859|Socs7|NAP4|NCKAP4|2310063P06Rik|C85125|Nap4 |
| Gene, Accession # | Gene ID: 30837,192157,287659 |
| Catalog # | ABIN634408 |
| Price | |
| Order / More Info | Suppressor of Cytokine Signaling 7 (SOCS7) (N-Term) Antibody from ANTIBODIES-ONLINE GmbH |
| Product Specific References | n/a |