| Edit |   |
| Antigenic Specificity | Cytokeratin 84 (Middle Region) |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | affinity purified |
| Size | 50 μg |
| Concentration | n/a |
| Applications | Western Blotting (WB) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The protein encoded by this gene is a member of the keratin gene family. As a type II hair keratin, it is a basic protein which heterodimerizes with type I keratins to form hair and nails. |
| Immunogen | Cytokeratin 84 antibody was raised using the middle region of KRT84 corresponding to a region with amino acids ESYITNLRRQLEVLVSDQARLQAERNHLQDVLEGFKKKYEEEVVCRANAE |
| Other Names | n/a |
| Gene, Accession # | n/a |
| Catalog # | ABIN631575 |
| Price | |
| Order / More Info | Cytokeratin 84 (Middle Region) Antibody from ANTIBODIES-ONLINE GmbH |
| Product Specific References | n/a |