| Edit |   |
| Antigenic Specificity | Clavesin 1 (CLVS1) (N-Term) |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human, mouse, rat |
| Isotype | n/a |
| Format | affinity purified |
| Size | 50 μg |
| Concentration | n/a |
| Applications | Western Blotting (WB) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | RLBP1L1 contains 1 CRAL-TRIO domain. It may be used as a marker for human hepatocellular carcinomas. |
| Immunogen | RLBP1 L1 antibody was raised using the N terminal of RLBP1 1 corresponding to a region with amino acids NFKADDPGIKRALIDGFPGVLENRDHYGRKILLLFAANWDQSRNSFTDIL |
| Other Names | RLBP1L1|rlbp1l1|CRALBPL|4933402J24Rik|Clvl1|Rlbp1l1|Clavesin-1|RGD1564200 |
| Gene, Accession # | Gene ID: 157807,74438,366311 |
| Catalog # | ABIN631673 |
| Price | |
| Order / More Info | Clavesin 1 (CLVS1) (N-Term) Antibody from ANTIBODIES-ONLINE GmbH |
| Product Specific References | n/a |