| Edit |   |
| Antigenic Specificity | AK4 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human (antigen sequence identity: mouse 94%, rat 90%) |
| Isotype | n/a |
| Format | antigen affinity purified |
| Size | 100 μl |
| Concentration | n/a |
| Applications | ICC-IF, IHC, WB. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues., Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein., Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Rabbit anti-human AK4 polyclonal antibody. |
| Immunogen | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: PEAVAARLRQYKDVAKPVIELYKSRGVLHQF |
| Other Names | adenylate kinase 4, AK3, AK3L1 |
| Gene, Accession # | Gene ID: 205, UniProt: P27144, ENSG00000162433 |
| Catalog # | HPA049461 |
| Price | |
| Order / More Info | AK4 Antibody from ATLAS ANTIBODIES AB |
| Product Specific References | n/a |