| Edit |   |
| Antigenic Specificity | Acyl-CoA Dehydrogenase, C-4 To C-12 Straight Chain (ACADM) (N-Term) |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human, dog |
| Isotype | n/a |
| Format | purified |
| Size | 100 μg |
| Concentration | n/a |
| Applications | Western Blotting (WB) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | ACADM Is the medium-chain specific (C4 to C12 straight chain) acyl-Coenzyme A dehydrogenase. The homotetramer enzyme catalyzes the initial step of the mitochondrial fatty acid beta-oxidation pathway. Clinical phenotypes are associated with ACADM hereditary deficiency. |
| Immunogen | ACADM antibody was raised using the N terminal of ACADM corresponding to a region with amino acids ATARKFAREEIIPVAAEYDKTGEYPVPLIRRAWELGLMNTHIPENCGGLG |
| Other Names | acaDM|ACAD1|MCAD|MCADH|AU018656 |
| Gene, Accession # | Gene ID: 34,490207 |
| Catalog # | ABIN629681 |
| Price | |
| Order / More Info | Acyl-CoA Dehydrogenase, C-4 To C-12 Straight Chain (ACADM) (N-Term) Antibody from ANTIBODIES-ONLINE GmbH |
| Product Specific References | n/a |