| 產(chǎn)品詳情 |
| Edit |   |
| Antigenic Specificity | Solute Carrier Family 25 (Mitochondrial Carrier, Brain), Member 14 (SLC25A14) |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human, mouse, rat, dog |
| Isotype | n/a |
| Format | purified |
| Size | 100 μg |
| Concentration | n/a |
| Applications | Western Blotting (WB) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Mitochondrial uncoupling proteins (UCP) are members of the larger family of mitochondrial anion carrier proteins (MACP). UCPs separate oxidative phosphorylation from ATP synthesis with energy dissipated as heat, also referred to as the mitochondrial proton leak. UCPs facilitate the transfer of anions from the inner to the outer mitochondrial membrane and the return transfer of protons from the outer to the inner mitochondrial membrane. They also reduce the mitochondrial membrane potential in mammalian cells. Tissue specificity occurs for the different UCPs and the exact methods of how UCPs transfer H+/OH- are not known. UCPs contain the three homologous protein domains of MACPs. SLC25A14 has an N-terminal hydrophobic domain that is not present in other UCPs. |
| Immunogen | SLC25 A14 antibody was raised using a synthetic peptide corresponding to a region with amino acids SIVAEFGTFPVDLTKTRLQVQGQSIDARFKEIKYRGMFHALFRICKEEGV |
| Other Names | ATPUMP5|DIC1|DICARBOXYLATE CARRIER 1|F14M13.10|F14M13_10|PLANT UNCOUPLING MITOCHONDRIAL PROTEIN 5|uncoupling protein 5|zgc:55596|BMCP1|UCP5|BMCP-1|Ucp5|UCP5L|UCP5S|Bmcp1 |
| Gene, Accession # | Gene ID: 9016,612910,20523,85263 |
| Catalog # | ABIN630323 |
| Price | |
| Order / More Info | Solute Carrier Family 25 (Mitochondrial Carrier, Brain), Member 14 (SLC25A14) Antibody from ANTIBODIES-ONLINE GmbH |
| Product Specific References | n/a |
| 產(chǎn)品資料 |
|
|