| Edit |   |
| Antigenic Specificity | Solute Carrier Family 25 (Mitochondrial Carrier, Phosphate Carrier), Member 24 (SLC25A24) |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | affinity purified |
| Size | 50 μg |
| Concentration | n/a |
| Applications | Western Blotting (WB) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | SLC25A24 is a calcium-dependent mitochondrial solute carrier. Mitochondrial solute carriers shuttle metabolites, nucleotides, and cofactors through the mitochondrial inner membrane. It may act as a ATP-Mg/Pi exchanger. |
| Immunogen | SLC25 A24 antibody was raised using a synthetic peptide corresponding to a region with amino acids MDSLYGDLFWYLDYNKDGTLDIFELQEGLEDVGAIQSLEEAKKIFTTGDV |
| Other Names | SLC25A24|2610016M12Rik|apc1|scamc-1|scamc1-A|slc25a24|APC1|SCAMC-1|EFINAL|SCAMC1 |
| Gene, Accession # | Gene ID: 29957 |
| Catalog # | ABIN635041 |
| Price | |
| Order / More Info | Solute Carrier Family 25 (Mitochondrial Carrier, Phosphate Carrier), Member 24 (SLC25A24) Antibody from ANTIBODIES-ONLINE GmbH |
| Product Specific References | n/a |