| Edit |   |
|---|
| Antigenic Specificity | Solute Carrier Family 25 (Mitochondrial Carrier, Phosphate Carrier), Member 25 (SLC25A25) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50 μg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | SLC25A25 is a calcium-dependent mitochondrial solute carrier. Mitochondrial solute carriers shuttle metabolites, nucleotides, and cofactors through the mitochondrial inner membrane. May act as a ATP-Mg/Pi exchanger that mediates the transport of Mg-ATP in exchange for phosphate, catalyzing the net uptake or efflux of adenine nucleotides into or from the mitochondria. |
|---|
| Immunogen | SLC25 A25 antibody was raised using a synthetic peptide corresponding to a region with amino acids MLQMLWHFLASFFPRAGCHGSREGDDREVRGTPAPAWRDQMASFLGKQDG |
|---|
| Other Names | mcsc|pcscl|scamc2|scamc-2|slc25a25|SLC25A25|1110030N17Rik|MCSC|mKIAA1896|Mcsc|Pcscl|PCSCL|RP11-395P17.4|SCAMC-2|slc25a|wu:fb13d12|wu:fd14e03|zgc:77454 |
|---|
| Gene, Accession # | Gene ID: 114789 |
|---|
| Catalog # | ABIN635361 |
|---|
| Price | |
|---|
| Order / More Info | Solute Carrier Family 25 (Mitochondrial Carrier, Phosphate Carrier), Member 25 (SLC25A25) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|