| Edit |   |
| Antigenic Specificity | ATL3 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human (antigen sequence identity: mouse 95%, rat 94%) |
| Isotype | n/a |
| Format | antigen affinity purified |
| Size | 100 μl |
| Concentration | n/a |
| Applications | ICC-IF |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Rabbit anti-human ATL3 polyclonal antibody. |
| Immunogen | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: NLAAAASAKDIYYNNMEEVCGGEKPYLSPDILEEKHCEFKQLALDHFKKTKKMGGKDFSFRYQQ |
| Other Names | atlastin GTPase 3, DKFZP564J0863 |
| Gene, Accession # | Gene ID: 25923, UniProt: Q6DD88, ENSG00000184743 |
| Catalog # | HPA076616 |
| Price | |
| Order / More Info | ATL3 Antibody from ATLAS ANTIBODIES AB |
| Product Specific References | n/a |