| Edit |   |
| Antigenic Specificity | Cartilage Associated Protein (CRTAP) (N-Term) |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | affinity purified |
| Size | 50 μg |
| Concentration | n/a |
| Applications | Western Blotting (WB) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The protein encoded by this gene is similar to the chicken and mouse CRTAP genes. The encoded protein is a scaffolding protein that may influence the activity of at least one member of the cytohesin/ARNO family in response to specific cellular stimuli. |
| Immunogen | CRTAP antibody was raised using the N terminal of CRTAP corresponding to a region with amino acids RLFGGLLRRAHCLKRCKQGLPAFRQSQPSREVLADFQRREPYKFLQFAYF |
| Other Names | zgc:85621|wu:fb47h01|CASP|LEPREL3|OI7|5730529N23Rik|Leprel3|RGD1565180 |
| Gene, Accession # | Gene ID: 10491 |
| Catalog # | ABIN635556 |
| Price | |
| Order / More Info | Cartilage Associated Protein (CRTAP) (N-Term) Antibody from ANTIBODIES-ONLINE GmbH |
| Product Specific References | n/a |