| Edit |   |
| Antigenic Specificity | NEK3 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | affinity purified |
| Size | 50 μg |
| Concentration | n/a |
| Applications | Western Blotting (WB) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | NEK3 is a member of the NimA (never in mitosis A) family of serine/threonine protein kinases. It differs from other NimA family members in that it is not cell cycle regulated and is found primarily in the cytoplasm. The kinase is activated by prolactin stimulation, leading to phosphorylation of VAV2 guanine nucleotide exchange factor, paxillin, and activation of the RAC1 GTPase. |
| Immunogen | NEK3 antibody was raised using a synthetic peptide corresponding to a region with amino acids FTQMCLGVNHIHKKRVLHRDIKSKNIFLTQNGKVKLGDFGSARLLSNPMA |
| Other Names | HSPK36|ATNEK3|NIMA-RELATED KINASE3|NIMA-related kinase 3|T8M17.60|T8M17_60 |
| Gene, Accession # | Gene ID: 4752 |
| Catalog # | ABIN634077 |
| Price | |
| Order / More Info | NEK3 Antibody from ANTIBODIES-ONLINE GmbH |
| Product Specific References | n/a |