| Edit |   |
|---|
| Antigenic Specificity | Eukaryotic Translation Initiation Factor 2 Subunit 1 (EIF2S1) (C-Term) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, mouse, rat, dog, zebrafish |
|---|
| Isotype | n/a |
|---|
| Format | purified |
|---|
| Size | 100 μg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB),Immunohistochemistry (IHC) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The translation initiation factor eIF2 catalyzes the first regulated step of protein synthesis initiation, promoting the binding of the initiator tRNA to 40S ribosomal subunits. Binding occurs as a ternary complex of methionyl-tRNA, eIF2, and GTP. eIF2 is composed of 3 nonidentical subunits, alpha (36 kDa), beta (38 kDa), and gamma (52 kDa). The rate of formation of the ternary complex is modulated by the phosphorylation state of eIF2-alpha. |
|---|
| Immunogen | EIF2 S1 antibody was raised using the C terminal of EIF2 1 corresponding to a region with amino acids RGVFNVQMEPKVVTDTDETELARQMERLERENAEVDGDDDAEEMEAKAED |
|---|
| Other Names | 0910001O23Rik|2410026C18Rik|35kDa|Eif2a|eIF2alpha|eif2|eif2s1|fb19d01|wu:fb19d01|EIF-2|EIF-2A|EIF-2alpha|EIF2|EIF2A|eif2a|CG9946|Dmel\\CG9946|Eif2alpha|IF2A_DROME|M(1)14C|M(1)19-153|M(1)8e3-10|deIF2alpha|eIF-2|eIF-2 a|eIF-2 alpha|eIF2 alpha|eIF2-alpha|eIF2a|eiF-2alpha|elF2alpha|l(1)14Cf|l(1)19-153 |
|---|
| Gene, Accession # | Gene ID: 321564,1965,480361,13665,54318 |
|---|
| Catalog # | ABIN629992 |
|---|
| Price | |
|---|
| Order / More Info | Eukaryotic Translation Initiation Factor 2 Subunit 1 (EIF2S1) (C-Term) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|