| Edit |   |
| Antigenic Specificity | Eukaryotic Translation Initiation Factor 3, Subunit G (EIF3G) (Middle Region) |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human, mouse, rat |
| Isotype | n/a |
| Format | affinity purified |
| Size | 50 μg |
| Concentration | n/a |
| Applications | Western Blotting (WB) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | EIF3G belongs to the eIF-3 subunit G family. It is a component of the eukaryotic translation initiation factor 3 (eIF-3) complex, which is required for several steps in the initiation of protein synthesis. |
| Immunogen | EIF3 G antibody was raised using the middle region of EIF3 corresponding to a region with amino acids LRDGASRRGESMQPNRRADDNATIRVTNLSEDTRETDLQELFRPFGSISR |
| Other Names | EIF3-P42|EIF3S4|eIF3-delta|eIF3-p44|44kDa|D0Jmb4|Eif3s4|TU-189B2|p44|eif3s4|zgc:56553|eIF3g-A|eif3s4-A|eIF3g|eIF3-S4|An16g05260|AO090011000648 |
| Gene, Accession # | Gene ID: 8666,53356,298700 |
| Catalog # | ABIN633566 |
| Price | |
| Order / More Info | Eukaryotic Translation Initiation Factor 3, Subunit G (EIF3G) (Middle Region) Antibody from ANTIBODIES-ONLINE GmbH |
| Product Specific References | n/a |