| Edit |   |
| Antigenic Specificity | Bleomycin Hydrolase (BLMH) (Middle Region) |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human, mouse, rat |
| Isotype | n/a |
| Format | affinity purified |
| Size | 50 μg |
| Concentration | n/a |
| Applications | Western Blotting (WB) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The normal physiological role of BLM hydrolase is unknown, but it catalyzes the inactivation of the antitumor drug BLM (a glycopeptide) by hydrolyzing the carboxamide bond of its B-aminoalaninamide moiety thus protecting normal and malignant cells from BLM toxicity. |
| Immunogen | BLMH antibody was raised using the middle region of BLMH corresponding to a region with amino acids EYLSNMVGGRKTLYNNQPIDFLKKMVAASIKDGEAVWFGCDVGKHFNSKL |
| Other Names | AI035728|Bh|Bmh|wu:fb13c01|zgc:66261|bh|bmh|BH|BMH |
| Gene, Accession # | Gene ID: 642,104184,287552 |
| Catalog # | ABIN631453 |
| Price | |
| Order / More Info | Bleomycin Hydrolase (BLMH) (Middle Region) Antibody from ANTIBODIES-ONLINE GmbH |
| Product Specific References | n/a |