| Edit |   |
| Antigenic Specificity | MMGT1 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human (antigen sequence identity: mouse 95%, rat 95%) |
| Isotype | n/a |
| Format | antigen affinity purified |
| Size | 100 μl |
| Concentration | n/a |
| Applications | IHC, WB. Recombinant expression validation in WB using target protein overexpression. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Rabbit anti-human MMGT1 polyclonal antibody. |
| Immunogen | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: KDMDATSELKNKTFDTLRNHPSFYVFNHRGRVLFRPSDTANSSNQDALSSNTSLKL |
| Other Names | membrane magnesium transporter 1, EMC5, TMEM32 |
| Gene, Accession # | Gene ID: 93380, UniProt: Q8N4V1, ENSG00000169446 |
| Catalog # | HPA032037 |
| Price | |
| Order / More Info | MMGT1 Antibody from ATLAS ANTIBODIES AB |
| Product Specific References | n/a |