| Edit |   |
| Antigenic Specificity | APOBEC3D |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human (antigen sequence identity: mouse 37%, rat 33%) |
| Isotype | n/a |
| Format | antigen affinity purified |
| Size | 100 μl |
| Concentration | n/a |
| Applications | IHC |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Rabbit anti-human APOBEC3D polyclonal antibody. |
| Immunogen | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: VFRGPVLPKRQSNHRQEVYFRFENHAEMCF |
| Other Names | apolipoprotein B mRNA editing enzyme catalytic subunit 3D, APOBEC3DE, APOBEC3E, ARP6 |
| Gene, Accession # | Gene ID: 140564, UniProt: Q96AK3, ENSG00000243811 |
| Catalog # | HPA055116 |
| Price | |
| Order / More Info | APOBEC3D Antibody from ATLAS ANTIBODIES AB |
| Product Specific References | n/a |