| Edit |   |
| Antigenic Specificity | COQ2 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human (antigen sequence identity: mouse 77%, rat 77%) |
| Isotype | n/a |
| Format | antigen affinity purified |
| Size | 100 μl |
| Concentration | n/a |
| Applications | ICC-IF, WB. Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Rabbit anti-human COQ2 polyclonal antibody. |
| Immunogen | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: NSGQTAPYYAALGAVGAHLTHQIYTLDIHRPEDCWNKFI |
| Other Names | coenzyme Q2 4-hydroxybenzoate polyprenyltransferase, CL640, FLJ26072 |
| Gene, Accession # | Gene ID: 27235, UniProt: Q96H96, ENSG00000173085 |
| Catalog # | HPA056599 |
| Price | |
| Order / More Info | COQ2 Antibody from ATLAS ANTIBODIES AB |
| Product Specific References | n/a |