| Edit |   |
| Antigenic Specificity | Ankyrin Repeat and LEM Domain Containing 2 (ANKLE2) (Middle Region) |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | affinity purified |
| Size | 50 μg |
| Concentration | n/a |
| Applications | Western Blotting (WB) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | KIAA0692 is a single-pass membrane protein. It contains 1 ANK repeat and 1 LEM domain. It contains 1 RING-type zinc finger. The function of KIAA0692 remains unknown. |
| Immunogen | KIAA0692 antibody was raised using the middle region of Kiaa0692 corresponding to a region with amino acids CYSPSDRQSWPSPAVKGRFKSQLPDLSGPHSYSPGRNSVAGSNPAKPGLG |
| Other Names | KIAA0692|LEMD7|Lem4|1110001J12Rik|AI661024|D5Ertd585e|RGD1310191 |
| Gene, Accession # | Gene ID: 23141 |
| Catalog # | ABIN631827 |
| Price | |
| Order / More Info | Ankyrin Repeat and LEM Domain Containing 2 (ANKLE2) (Middle Region) Antibody from ANTIBODIES-ONLINE GmbH |
| Product Specific References | n/a |