| Edit |   |
| Antigenic Specificity | Ankyrin Repeat and SAM Domain-Containing Protein 3 (ANKS3) (N-Term) |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human, mouse |
| Isotype | n/a |
| Format | affinity purified |
| Size | 50 μg |
| Concentration | n/a |
| Applications | Western Blotting (WB) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | ANKS3 contains 1 SAM (sterile alpha motif) domain and 6 ANK repeats. The exact function of ANKS3 remains unknown. |
| Immunogen | ANKS3 antibody was raised using the N terminal of ANKS3 corresponding to a region with amino acids WHGLGTQVSGEELDVPLDLHTAASIGQYEVVKECVQRRELDLNKKNGGGW |
| Other Names | 2700067D09Rik|C81345|mKIAA1977|RGD1305833 |
| Gene, Accession # | Gene ID: 124401,72615 |
| Catalog # | ABIN632034 |
| Price | |
| Order / More Info | Ankyrin Repeat and SAM Domain-Containing Protein 3 (ANKS3) (N-Term) Antibody from ANTIBODIES-ONLINE GmbH |
| Product Specific References | n/a |