| 產(chǎn)品詳情 |
| Edit |   |
| Antigenic Specificity | Cholinergic Receptor, Nicotinic, beta 2 (Neuronal) (CHRNB2) |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | purified |
| Size | 100 μg |
| Concentration | n/a |
| Applications | Western Blotting (WB),Immunohistochemistry (IHC) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Mutations in nAChRs are found in a rare form of nocturnal frontal lobe epilepsy . Previously, some nAChR mutations have been described that are associated with additional neurological features such as psychiatric disorders or cognitive defects. A new CHRNB2 mutation located in transmembrane region 3 (M3), outside the known ADNFLE mutation cluster. The CHRNB2 mutation I312M, which occurred de novo in twins, markedly increases the receptor's sensitivity to acetylcholine. Phenotypically, the mutation is associated not only with typical ADNFLE, but also with distinct deficits in memory. The cognitive problems are most obvious in tasks requiring the organization and storage of verbal information. |
| Immunogen | CHRNB2 antibody was raised using a synthetic peptide corresponding to a region with amino acids CKIEVKHFPFDQQNCTMKFRSWTYDRTEIDLVLKSEVASLDDFTPSGEWD |
| Other Names | EFNL3|nAChRB2|NACHRB2|Acrb-2|Acrb2|C030030P04Rik|[b]2-nAchR |
| Gene, Accession # | Gene ID: 1141 |
| Catalog # | ABIN630117 |
| Price | |
| Order / More Info | Cholinergic Receptor, Nicotinic, beta 2 (Neuronal) (CHRNB2) Antibody from ANTIBODIES-ONLINE GmbH |
| Product Specific References | n/a |
| 產(chǎn)品資料 |
|
|